.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of C-terminal domain of transcription-repair coupling factor. To be Published
    Site NYSGXRC
    PDB Id 2qsr Target Id NYSGXRC-10118d
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS7973,Q8DRQ1, PF03461 Molecular Weight 134794.66 Da.
    Residues 1169 Isoelectric Point 5.45
    Sequence mvtlldlfsendqikkwhqnltdkkrqlilglststkalaiasslekedrivlltstygeaeglvsdli silgeelvypflvddapmveflmssqekiisrvealrfltdsskkgilvcniaasrlilpspnafkdsi vkisvgeeydqhafihqlkengyrkvtqvqtqgefslrgdildifeisqlepcrieffgdeidgirsfe vetqlskenkteltifpasdmllrekdyqrgqsalekqisktlspilksyleeilssfhqkqshadsrk flslcydktwtvfdyiekdtpiffddyqklmnqyevferelaqyfteelqnskafsdmqyfsdieqiyk kqspvtffsnlqkglgnlkfdkiyqfnqypmqeffnqfsflkeeierykkmdytiilqssnsmgsktle dmleeyqikldsrdktsickesvnliegnlrhgfhfvdekilliteheifqkklkrrfrrqhvsnaerl kdynelekgdyvvhhihgigqylgietieikeihrdyvsvqyqngdqisipveqihllskyissdgkap klnklndghfkkakqkvknqvediaddliklysersqlkgfafsaddddqdafddafpyvetddqlrsi eeikrdmqasqpmdrllvgdvgfgktevamraafkavndhkqvvilvpttvlaqqhytnfkerfqnfav nvdvlsrfrskkeqtatleklkngqvdiligthrvlskdvvfadlglmiideeqrfgvkhketlkelkk qvdvltltatpiprtlhmsmlgirdlsvietpptnrypvqtyvlekndsvirdavlremerggqgyyly nkvdtivqkvselqelipeasigyvhgrmsevqlentlldfiegqydilvtttiietgvdipnantlfi enadhmglstlyqlrgrvgrsnriayaylmyrpeksisevsekrleaikgftelgsgfkiamrdlsirg agnllgksqsgfidsvgfelysqlleeaiakrngnanantrtkgnaelilqidaylpdtyisdqrhkie iykkirqidnrvnyeelqeelidrfgeypdvvaylleiglvksyldkvfvqrverkdnkitiqfekvtq rlflaqdyfkalsvtnlkagiaenkglmelvfdvqnkkdyeilegllifgeslleikeskeknsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.10 Rfree 0.243
    Matthews' coefficent 3.09 Rfactor 0.184
    Waters Solvent Content 60.25

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch