.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qt3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-Isopropylammelide isopropylaminohydrolase AtzC from Pseudomonas sp. strain ADP complexed with Zn. To be Published
    Site NYSGXRC
    PDB Id 2qt3 Target Id NYSGXRC-9364b
    Molecular Characteristics
    Source Pseudomonas
    Alias Ids TPS7827,NP_862508 Molecular Weight 44935.96 Da.
    Residues 403 Isoelectric Point 5.33
    Sequence mskdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgfvdahthmdksfts tgerlpkfwsrpytrdaaiedglkyyknatheeikrhviehahmqvlhgtlytrthvdvdsvaktkave avleakeelkdlidiqvvafaqsgffvdleseslirksldmgcdlvggvdpatrennvegsldlcfkla keydvdidyhihdigtvgvysinrlaqktiengykgrvttshawcfadapsewldeaiplykdsgmkfv tcfsstpptmpviklleaginlgcasdnirdfwvpfgngdmvqgalietqrlelktnrdlgliwkmits egarvlgieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.24 Rfree 0.247
    Matthews' coefficent 3.32 Rfactor 0.226
    Waters 157 Solvent Content 62.97

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2qt3
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch