.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qu7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative transcription regulator from Staphylococcus saprophyticus subsp. saprophyticus. To be Published
    Site NYSGXRC
    PDB Id 2qu7 Target Id NYSGXRC-11018x
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS7884,Q4A0A0_STAS1, 3.40.50.2300, PF00532 Molecular Weight 37634.24 Da.
    Residues 338 Isoelectric Point 8.22
    Sequence mknnkptlhdvarvagvsiatvsnvlnnksselsdktkdkvlnaietlnyepnqfarglktgrsniiaf ivpdqnpfftevlteishecqkhhlhvavasseenedkqqdlietfvsqnvsaiilvpvkskfqmkrew lkipimtldrelestslpsitvdneeaayiatkrvlestckevglllanpnisttigrkngynkaisef dlnvnpslihysdqqlgtnaqiysgyeatktllskgikgivatnhllllgalqaikesekeikkdviiv gfddsywneiytpkltvisqpvkemgqvaakmiyklikgkdvtsiklstkliirescsfnkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.268
    Matthews' coefficent 2.86 Rfactor 0.205
    Waters 130 Solvent Content 57.06

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch