.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qup

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uncharacterized Protein Bh1478 from Bacillus Halodurans. To be Published
    Site NYSGXRC
    PDB Id 2qup Target Id NYSGXRC-10015d
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS7934,PF03885, Q9KCU1 Molecular Weight 16577.47 Da.
    Residues 145 Isoelectric Point 9.57
    Sequence mdvqrvgkaglhrvdskkqqtaagvsfsevmgkqrdekayerlqalmskiddqgkllsetrtieelrky kelvkefvgdavelglrleerrgfnrrgrtkiykivkevdrklldltdavlakekkgldilnmvgeikg lliniya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2287
    Matthews' coefficent 2.80 Rfactor 0.20804
    Waters 99 Solvent Content 58.00

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch