The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uncharacterized Protein Atu2773 from Agrobacterium Tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 2qv5 Target Id NYSGXRC-10097f
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7962,Q8UBS7, PF04748 Molecular Weight 41975.19 Da.
    Residues 399 Isoelectric Point 8.07
    Sequence lssdlrkpllgrqkksaginrrfsvimllsvlavlsigglsiytalspgnlqktaagpdgqpqlaekap ekaqvdvpaagdtaglqpqsgrsganinratlpdgnvvsvysprprdsdgpvlmsgqtygqdprmatrp neelleetafgqlpvvgadglrpmeqyarpwsgargtrvaivvgglglsqtgsqkairdlppevtlgfa asgnslqrwmqdarregheillqiplepfgypgtnpgpdtllagdpakvnidrlhrsmakitnytgvmn ylggrflaeqsalepvmrdigkrgllflddgssaqslsggiakaisapqgfadvlldgevteasilrkl ddleriarrngqaigvasafdesiaaiskwsreaggrgieivgvsalvsgqagq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23838
    Matthews' coefficent 2.00 Rfactor 0.17786
    Waters 298 Solvent Content 38.60

    Ligand Information
    Ligands GOL (GLYCEROL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch