.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a periplasmic sugar ABC transporter from Thermotoga maritima. To be Published
    Site NYSGXRC
    PDB Id 2qvc Target Id NYSGXRC-11013q
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS7876,3.40.50.2300, Q9WXW9_THEMA, PF00532 Molecular Weight 36108.21 Da.
    Residues 335 Isoelectric Point 5.14
    Sequence mwnktslqggvimrkllvflsvllvaglslaltigvigksvhpywsqveqgvkaagkalgvdtkffvpq kedinaqlqmlesfiaegvngiaiapsdptaviptikkalemgipvvtldtdspdsgryvyigtdnyqa gytaglimkellggkgkvvigtgsltamnslqriqgfkdaikdseieivdilndeedgaravslaeaal nahpdldaffgvyayngpaqalvvknagkvgkvkivcfdttpdilqyvkegviqatmgqrpymmgylsv tvlylmnkigvqntlmmlpkvkvdgkvdyvidtgvdvvtpenldeylkkmeelgipikf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.243
    Matthews' coefficent 2.98 Rfactor 0.212
    Waters 287 Solvent Content 58.73

    Ligand Information
    Ligands BGC (BETA-D-GLUCOSE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2qvc
    1. Crystal structure of TTHA0807, a CcpA regulator, from Thermus thermophilus HB8
    T Kumarevel, T Tanaka, A Shinkai - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch