.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qvg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a two-component response regulator from Legionella pneumophila. To be Published
    Site NYSGXRC
    PDB Id 2qvg Target Id NYSGXRC-11016o
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS7879,3.40.50.2300, Q5ZSR0_LEGPH, PF00072 Molecular Weight 15596.25 Da.
    Residues 136 Isoelectric Point 5.04
    Sequence vmdlaadkvdilyleddevdiqsvervfhkisslikieiaksgnqaldmlygrnkenkihpklilldin ipkmngieflkelrddssftdievfvltaaytskdklafeslnirghlikpldygeaiklfwilqsm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.255
    Matthews' coefficent 2.38 Rfactor 0.218
    Waters 171 Solvent Content 48.34

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch