.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qvh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of O-succinylbenzoate synthase complexed with O-succinyl benzoate. To be Published
    Site NYSGXRC
    PDB Id 2qvh Target Id NYSGXRC-9312b
    Related PDB Ids 2opj 
    Molecular Characteristics
    Source Thermobifida fusca
    Alias Ids TPS7820,PF01188 Molecular Weight 34098.03 Da.
    Residues 317 Isoelectric Point 5.14
    Sequence mtgrafaiplrtrfrgitvregmlvrgaagwgefspfaeygprecarwwaacyeaaelgwpapvrdtvp vnatvpavgpeeaarivassgcttakvkvaergqseandvarveavrdalgprgrvridvngawdvdta vrmirlldrfeleyveqpcatvdelaevrrrvsvpiaadesirraedplrvrdaeaadvvvlkvqplgg vraalrlaeecglpvvvssavetsvglaagvalaaalpelpyacglatlrllhadvcddpllpvhgvlp vrrvdvseqrlaeveidpaawqarlaaaraaweqverepgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.251
    Matthews' coefficent 1.92 Rfactor 0.218
    Waters 286 Solvent Content 35.80

    Ligand Information
    Ligands OSB (2-SUCCINYLBENZOATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 2qvh
    1. Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member
    HJ Li, X Li, N Liu, H Zhang, JJ Truglio, S Mishra - Biochemistry, 2011 - ACS Publications
     
    2. Residues required for activity in Escherichia coli o-succinylbenzoate synthase are not conserved in all OSBS enzymes
    WW Zhu, C Wang, J Jipp, L Ferguson, SN Lucas - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch