.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qw6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal domain of an AAA ATPase from Enterococcus faecium DO. To be Published
    Site NYSGXRC
    PDB Id 2qw6 Target Id NYSGXRC-10353s
    Related PDB Ids 2r9g 
    Molecular Characteristics
    Source Enterococcus faecium
    Alias Ids TPS8018,Q3XY27_ENTFC, BIG_278 Molecular Weight 47397.50 Da.
    Residues 428 Isoelectric Point 7.25
    Sequence mqqplayrmrprtidevvgqqhlvgegkiirrmvdarmlssmilygppgtgktsiasaiagstnyafrm lnaatdskkdlqvvaeeakmsgtvillldevhrldktkqdfllphlesgriiligattenpyitinpai rsrtqifevkplteqdiqlavehalrdkerglgqqaiqldedallhlsratngdlrsalnglelatlst psdkegrihltlsiieecvqrkalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasic rrlmvigyediglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladir egkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqq yyrikewkkhppkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.275
    Matthews' coefficent 2.50 Rfactor 0.224
    Waters 65 Solvent Content 50.78

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch