.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qwt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the TetR transcription regulatory protein from Mycobacterium vanbaalenii. To be Published
    Site NYSGXRC
    PDB Id 2qwt Target Id NYSGXRC-10398j
    Molecular Characteristics
    Source Mycobacterium vanbaalenii
    Alias Ids TPS8031,BIG_838, PF00440, Q267S8_MYCVN Molecular Weight 19730.55 Da.
    Residues 186 Isoelectric Point 5.77
    Sequence vtrplradaarnrarvlevaydtfaaeglgvpideiarragvgagtvyrhfptkqalvvavaedrvrri vdhartllaaegpgealfvflrdmvrsaaadyglvdalvgygldlevaapgaeaaflatlgellaaaqr agtvradvdvavikallvvckvpqvydgevservvrviedglrvrssv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.279
    Matthews' coefficent 1.94 Rfactor 0.255
    Waters 5 Solvent Content 36.45

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qwt
    1. Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolorA3 (2) reveals an unusual dimer among TetR family proteins
    EV Filippova, M Chruszcz, M Cymborowski - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch