The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized conserved protein from Methanopyrus kandleri. To be Published
    Site NYSGXRC
    PDB Id 2qya Target Id NYSGXRC-10169d
    Molecular Characteristics
    Source Methanopyrus kandleri
    Alias Ids TPS7988,PF04242, Q8TWR4 Molecular Weight 12487.62 Da.
    Residues 114 Isoelectric Point 4.79
    Sequence marvllnihgtgdtvvlalcdedllgvelkykgrtlhisepfysgkslepdraakkireavqeyedekt vainalgelacsvvvdaglaredeigelggvphvqiyilprepfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.17 Rfree 0.291
    Matthews' coefficent 2.52 Rfactor 0.234
    Waters 91 Solvent Content 51.20

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch