.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the uncharacterized protein CTC02137 from Clostridium tetani E88. To be Published
    Site NYSGXRC
    PDB Id 2qyz Target Id NYSGXRC-10427h
    Molecular Characteristics
    Source Clostridium tetani
    Alias Ids TPS8045,BIG_182, Q892G2_CLOTE Molecular Weight 15151.44 Da.
    Residues 129 Isoelectric Point 4.99
    Sequence mnrevkfrawdkelnmmvytkeqtghieyntnpadtiniilnqddygyvfmqytglkdknekeiyegdi ikksnrssnlyeiiyqdsiacfrckvikgdiksfpclnigtvrncevigniyenpellee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.259
    Matthews' coefficent 2.29 Rfactor 0.191
    Waters 67 Solvent Content 46.26

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch