.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qzb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the uncharacterized protein yfeY from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 2qzb Target Id NYSGXRC-10326a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8016,PF06572, P76537 Molecular Weight 20896.50 Da.
    Residues 191 Isoelectric Point 5.21
    Sequence mkslrlmlcamplmltgcstmssvnwsaanpwnwfgsstkvseqgvgeltastplqeqaiadaldgdyr lrsgmktangnvvrffevmkgdnvamvingdqgtisridvldsdipadtgvkigtpfsdlyskafgncq kadgddnraveckaegsqhisyqfsgewrgpeglmpsddtlknwkvskiiwrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.296
    Matthews' coefficent 2.05 Rfactor 0.217
    Waters 113 Solvent Content 39.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch