.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qzj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a two-component response regulator from Clostridium difficile. To be Published
    Site NYSGXRC
    PDB Id 2qzj Target Id NYSGXRC-11017x
    Molecular Characteristics
    Source Clostridium difficile
    Alias Ids TPS7881,3.40.50.2300, Q180B0_CLOD6, PF00072 Molecular Weight 26202.80 Da.
    Residues 226 Isoelectric Point 5.71
    Sequence mqtkiliidgdkdncqklkgfleekgisidlaynceeaigkifsnkydlifleiilsdgdgwtlckkir nvttcpivymtyinedqsilnalnsggddylikplnleilyakvkailrrmnsyvnnnenntkleeynr tsgvikledkiikltptenkllnffienpektlttkeiyehvwmneylednysvvvavnglrkkiekdy knpqkiitirgagyyfnke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.89 Rfree 0.285
    Matthews' coefficent 2.35 Rfactor 0.219
    Waters 78 Solvent Content 47.56

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch