.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r1f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Predicted Aminodeoxychorismate Lyase from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 2r1f Target Id NYSGXRC-10099a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7963,PF02618, Q8FIP0 Molecular Weight 30285.02 Da.
    Residues 269 Isoelectric Point 8.81
    Sequence llriepdlshfkagtyrftpqmtvremlkllesgkeaqfplrlvegmrlsdylkqlreapyikhtlsdd kyatvaqalelenpewiegwfwpdtwmytanttdvallkrahkkmvkavdsawegradglpykdknqlv tmasiieketavaserdqvasvfinrlrigmrlqtdptviygmgeryngklsradletptayntytitg lppgaiatpgadslkaaahpaktpylyfvadgkgghtfntnlashnksvqdylkvlkeknaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.25708
    Matthews' coefficent 3.22 Rfactor 0.22281
    Waters 251 Solvent Content 61.90

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 3
    Metals CD (CADMIUM) x 15

    Jmol

     
    Google Scholar output for 2r1f
    1. The catalytic domain of the germination_specific lytic transglycosylase SleB from Bacillus anthracis displays a unique active site topology
    X Jing, HR Robinson, JD Heffron - Proteins: Structure, , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch