.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r5x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein YugN from Geobacillus kaustophilus HTA426. To be Published
    Site NYSGXRC
    PDB Id 2r5x Target Id NYSGXRC-10410m
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS8035,BIG_5, Q5L106_GEOKA Molecular Weight 13898.03 Da.
    Residues 119 Isoelectric Point 5.41
    Sequence mkfentglenqtvelsrlddimerlgfvraaqwdyervtydrkyvvkegtyylrvqgyaiegnvdsrya liklltpilgkhyyphgveygddehfpsslvsqcqnvlaqvkselekike
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.23344
    Matthews' coefficent 2.04 Rfactor 0.1981
    Waters 133 Solvent Content 39.72

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r5x
    1. Structure of LP2179, the first representative of Pfam family PF08866, suggests a new fold with a role in amino-acid metabolism
    C Bakolitsa, A Kumar, D Carlton, MD Miller - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch