.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r8c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of amidohydrolase Eaj56179. To be Published
    Site NYSGXRC
    PDB Id 2r8c Target Id NYSGXRC-9260b
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7789,PF01979 Molecular Weight 44390.52 Da.
    Residues 416 Isoelectric Point 5.49
    Sequence mttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimpglidlhvhvvai efnlprvatlpnvlvtlravpimramlrrgfttvrdaggagypfkqavesglvegprlfvsgralsqtg ghadprarsdymppdspcgccvrvgalgrvadgvdevrravreelqmgadqikimasggvasptdpvgv fgysedeiraivaeaqgrgtyvlahaytpaaiaravrcgvrtiehgnliddetarlvaehgayvvptlv tydalasegekyglppesiakiadvhgaglhsieimkragvkmgfgtdllgeaqrlqsdefrilaevls paeviasativsaevlgmqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnelegh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.31 Rfree 0.24082
    Matthews' coefficent 2.48 Rfactor 0.20535
    Waters 813 Solvent Content 50.46

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 16

    Jmol

     
    Google Scholar output for 2r8c
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Functional Identification of Incorrectly Annotated Prolidases from the Amidohydrolase Superfamily of Enzymes
    DF Xiang, Y Patskovsky, C Xu, AJ Meyer - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch