.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r9g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the C-Terminal Domain of AAA ATPase from Enterococcus faecium. To be Published
    Site NYSGXRC
    PDB Id 2r9g Target Id NYSGXRC-10353s
    Related PDB Ids 2qw6 
    Molecular Characteristics
    Source Enterococcus faecium
    Alias Ids TPS8019,Q3XY27_ENTFC, BIG_278 Molecular Weight 47397.50 Da.
    Residues 428 Isoelectric Point 7.25
    Sequence mqqplayrmrprtidevvgqqhlvgegkiirrmvdarmlssmilygppgtgktsiasaiagstnyafrm lnaatdskkdlqvvaeeakmsgtvillldevhrldktkqdfllphlesgriiligattenpyitinpai rsrtqifevkplteqdiqlavehalrdkerglgqqaiqldedallhlsratngdlrsalnglelatlst psdkegrihltlsiieecvqrkalthdkngdahydvisafqksirgsdvdaalhylarlveagdlasic rrlmvigyediglgnpaaaartvnavlaaeklglpearipladvvvdlclspksnsaymaldaaladir egkagdvpdhlrdshykgakslnrgvgyqyphhfdqawvnqqylpdklknaqyyqpkdtgkyeqalgqq yyrikewkkhppkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 16
    Resolution (Å) 2.09 Rfree 0.248
    Matthews' coefficent 2.43 Rfactor 0.197
    Waters 1338 Solvent Content 49.33

    Ligand Information
    Ligands ACT (ACETATE) x 12;GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch