.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rdm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of response regulator receiver protein from Sinorhizobium medicae WSM419. To be Published
    Site NYSGXRC
    PDB Id 2rdm Target Id NYSGXRC-11010g
    Molecular Characteristics
    Source Sinorhizobium medicae
    Alias Ids TPS7872,3.40.50.2300, Q0MD82_9RHIZ, PF00072 Molecular Weight 13838.97 Da.
    Residues 131 Isoelectric Point 4.28
    Sequence meavtilladdeaillldfestltdagflvtavssgakaiellksgaaidgvvtdirfcqppdgwqvar vareidpnmpivyisghaalewasngvpdsiilekpftsaqlitavsqllnarpprappsda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.76 Rfree 0.22006
    Matthews' coefficent 2.23 Rfactor 0.18768
    Waters 198 Solvent Content 44.76

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 2rdm
    1. Surface-bound proteins with preserved functionality
    J Wan, MS Thomas, S Guthrie, VI Vullev - Annals of biomedical , 2009 - Springer
     
    2. Marius RETEGAN
    ID Raporteur - 2009 - hal.archives-ouvertes.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch