.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rdy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative glycoside hydrolase family protein from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 2rdy Target Id NYSGXRC-10436a
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8047,Q9KEL0_BACHD, BIG_775 Molecular Weight 89243.89 Da.
    Residues 795 Isoelectric Point 5.39
    Sequence mkiqfdfpasfwtealpigngnlgamvfgkvekerialnedtlwsgypkdwnnpkakevlpkvreliaq ekyeeadqlsrdmmgpytqsylpfgdlnifmdhgqvvaphyhreldlstgivtvtytiggvqytrelfv typdraivvrltaskegflsfrakldsllrhvssvgaehytisgtapehvspsyydeenpvryghpdms qgmtfhgrlaavneggslkvdadglhvmgatcatlyfsastsfdpstgasclerdpslrtietikaick rgykeivnrhledytklfnrvslhlgesiapadmstdqrikeygsrdlglvellfqygrylmiassrpg tqpanlqgiwneetrapwssnytlninaemnywpaetcnlaelhkplihfierlaangkktaeinygar gwvahhnadlwgqtapvgdfghgdpvwafwpmggvwltqhlwehytfgedeaylrdtaypimkeaalfc ldwlieneagylvtspstspeqrfrigekgyavssattmdlsliaecfdnciqaakrlsidedfvkals dakqrllplqigkrgqlqewsndfededvhhrhvshlvgiypgrliteqsapnlfeaaktsleirgdeg tgwslgwkislwarfkdgnrcerllsnmltlikedesmqhrggvyanlfgahppfqidgnfsatagiae mllqshqgyleflpalpdswkdgyvkglrgrggyevdlawtngalvkveivstktqtcevltrismrit esgeevegdvldsgrmsfqvekgkryvlnrttdgdf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.03 Rfree 0.225
    Matthews' coefficent 2.54 Rfactor 0.198
    Waters 559 Solvent Content 51.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch