.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rg4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the uncharacterized protein Q2CBJ1_9RHOB from Oceanicola granulosus HTCC2516. To be Published
    Site NYSGXRC
    PDB Id 2rg4 Target Id NYSGXRC-10416f
    Molecular Characteristics
    Source Rhodobacterales
    Alias Ids TPS8037,Q2CBJ1_9RHOB, BIG_189 Molecular Weight 23077.76 Da.
    Residues 206 Isoelectric Point 4.90
    Sequence maqikslfatrlyhaplsehgpaldpaefaascysiaedddagqewceregypgytsyasltdlpwrfp ifadlvksldahvaafaedlefeldgkalrlediwinilpeggvhgshihphsvisgttyvampegtsa lkledprlpfmmaaptrrkgareelrtfrsvapkvgdvllweswlrhevpmnmaeedrisvsfnyawg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.277
    Matthews' coefficent 2.04 Rfactor 0.207
    Waters 347 Solvent Content 39.78

    Ligand Information
    Ligands
    Metals FE (FE) x 2

    Jmol

     
    Google Scholar output for 2rg4
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. BetaSearch: a new method for querying beta-residue motifs
    HK Ho, G Gange, MJ Kuiper - BMC Research , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch