.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rjn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein Q2BKU2 from Neptuniibacter caesariensis. To be Published
    Site NYSGXRC
    PDB Id 2rjn Target Id NYSGXRC-11008k
    Molecular Characteristics
    Source Oceanospirillum sp.
    Alias Ids TPS7866,3.40.50.2300, Q2BKU2_9GAMM, PF00072 Molecular Weight 48376.15 Da.
    Residues 425 Isoelectric Point 5.76
    Sequence mnyknytvmlvddeqpilnslkrlikrlgcniitftspldalealkgtsvqlvisdmrmpemggevfle qvaksypdiervvisgyadaqatidavnrgkisrfllkpwededvfkvvekglqlaflreenlrlqeet eaknkqlkqlnqgleekvkertqqiiqandrlktnyrsvvrmfsalatrrlgvrasgeniklnkilllv asktglkdqdlkqlyyawqlrqigklsfsdelikepylklgaeqqrefqnhpllaqaaclmvkplypag kiilqhkeyldgsgypkgikgeeitfraqvlavvndyvelihglydereystdeaitylsdkakerynq dvvallarvveelsksgdtlndkavfsdqlkpgmklsrdlisgdgmlllsadqvldgvaieriremefn ldetfkvyvsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.236
    Matthews' coefficent 2.69 Rfactor 0.185
    Waters 64 Solvent Content 54.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch