.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rjo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of twin-arginine translocation pathway signal protein from Burkholderia phytofirmans. To be Published
    Site NYSGXRC
    PDB Id 2rjo Target Id NYSGXRC-11011y
    Molecular Characteristics
    Source Burkholderia phymatum
    Alias Ids TPS7874,3.40.50.2300, A0GG20_9BURK Molecular Weight 38278.59 Da.
    Residues 359 Isoelectric Point 9.06
    Sequence mnrqdqragvsrrdfiklgagaafavagggmsglsfgagqttlacsfrsltnpyytafnkgaqsfaksv glpyvplttegssekgiadirallqktggnlvlnvdpndsadarviveacskagayvttiwnkpkdlhp wdynpnyvahlsydgvaygeetatqlfksmggkggvvalggifsnvpaierkagldaalkkfpgiqlld fqvadwnsqkafpimqawmtrfnskikgvwaanddmalgaiealraeglagqipvtgmdgtqpglvaik sgelvasvdwdpfwlggiglsmglqakekkidlatlpkdrresfctatfvtktnvqdviaraaspkaew nnlyarvagpvvyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.281
    Matthews' coefficent 2.53 Rfactor 0.234
    Waters 119 Solvent Content 51.35

    Ligand Information
    Ligands GAL (BETA-D-GALACTOSE) x 1;SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2rjo
    1. Protein engineering for biosensor development
    AE Miklos - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch