.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rjz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex. J.Mol.Biol. 394 143-159 2009
    Site NYSGXRC
    PDB Id 2rjz Target Id NYSGXRC-10146c
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS7979,Q51353, PF04350 Molecular Weight 22817.99 Da.
    Residues 207 Isoelectric Point 5.04
    Sequence mslassleslrkidindldlnnigswpaavkvivcvlltaavlalgynfhlsdmqaqleqqaaeeetlk qqfstkafqaanleaykaqmkemeesfgallrqlpsdtevpglleditrtglgsglefeeikllpevaq qfyielpiqisvvggyhdlatfvsgvsslprivtlhdfeikpvapgstsklrmsilaktyryndkglkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.234
    Matthews' coefficent 2.52 Rfactor 0.193
    Waters 95 Solvent Content 51.16

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2rjz
    1. Periplasmic domains of Pseudomonas aeruginosa PilN and PilO form a stable heterodimeric complex
    LM Sampaleanu, JB Bonanno, M Ayers, J Koo - Journal of molecular , 2009 - Elsevier
     
    2. How Pseudomonas aeruginosa Twitches: Type IV Pili at Work
    L Burrows - Annual Review of Microbiology, 2012 - annualreviews.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch