.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rk0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from Frankia sp. EAN1pec. To be Published
    Site NYSGXRC
    PDB Id 2rk0 Target Id NYSGXRC-11002z
    Molecular Characteristics
    Source Frankia sp.
    Alias Ids TPS7856,PF00903, 3.10.180.10, Q3W3Y2_9ACTO Molecular Weight 14071.09 Da.
    Residues 128 Isoelectric Point 4.63
    Sequence mplsgvshvsltvrdldiscrwyteildwkelvrgrgdttsfahgvlpgglsivlrehdgggtdlfdet rpgldhlsfsvesmtdldvleerlakagaaftptqelpfgwilafrdadnialeamlgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.256
    Matthews' coefficent 2.44 Rfactor 0.215
    Waters 138 Solvent Content 49.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rk0
    1. Molecular architecture and structural basis of allosteric regulation of eukaryotic phosphofructokinases
    N Strter, S Marek, EB Kuettner, M Kloos, A Keim - The FASEB Journal, 2011 - FASEB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch