.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rk9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase superfamily member from Vibrio splendidus 12B01. To be Published
    Site NYSGXRC
    PDB Id 2rk9 Target Id NYSGXRC-11005r
    Molecular Characteristics
    Source Vibrio splendidus
    Alias Ids TPS7862,ZP_00988638, PF00903, 3.10.180.10 Molecular Weight 15468.68 Da.
    Residues 135 Isoelectric Point 4.24
    Sequence mtlrvvpelycfdinvsqsffvdvlgfevkyerpdeefvyltldgvdvmlegiagksrkwlsgdlefpl gsgvnfqwdvidieplyqrvnesaadsiylalesksyqcgdsiatqkqfivqtpdgylfrfcqdih
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.229
    Matthews' coefficent 1.97 Rfactor 0.209
    Waters 218 Solvent Content 37.52

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch