.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b2n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DNA-binding response regulator, LuxR family, from Staphylococcus aureus. To be Published
    Site NYSGXRC
    PDB Id 3b2n Target Id NYSGXRC-11008x
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS7868,3.40.50.2300, Q1XZE1_STAAU, PF00072 Molecular Weight 22782.14 Da.
    Residues 200 Isoelectric Point 5.03
    Sequence mtsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiempgmtglevlaei rkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkvnngekeysatlmtsffvdkn pltpkeqivlreignglsskeiseklfltdgtvrnytsviidklfadnrfdawkkanekgwi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.215
    Matthews' coefficent 2.42 Rfactor 0.165
    Waters 57 Solvent Content 49.21

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3b2n
    1. 1.9 A structure of the signal receiver domain of the putative response regulator NarL from Mycobacterium tuberculosis
    R Schnell, D Agren, G Schneider - Acta Crystallographica Section F: , 2008 - scripts.iucr.org
     
    2. Anti-biofilm activity of Salvadora persica on cariogenic isolates of Streptococcus mutans: in vitro and molecular docking studies
    S Al-Sohaibani, K Murugan - Biofouling, 2012 - Taylor & Francis
     
    3. Crystal structure of receiver domain of putative NarL family response regulator spr1814 from Streptococcus pneumoniae in the absence and presence of the
    AK Park, JH Moon, KS Lee, YM Chi - Biochemical and Biophysical , 2012 - Elsevier
     
    4. Structural enzymology of dormancy related proteins from Mycobacterium tuberculosis
    D gren - 2008 - diss.kib.ki.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch