.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b89

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of rRNA methylase from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 3b89 Target Id NYSGXRC-10094b
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS7959,PF07091, Q763K9 Molecular Weight 27405.96 Da.
    Residues 251 Isoelectric Point 6.45
    Sequence mnindaltsilaskkyralcpdtvrrilteewgrhkspkqtveaartrlhgicgayvtpeslkaaaaal sagdvkkalslhastkerlaeldtlydfifsaetprrvldiacglnplalyergiasvwgcdihqglgd vitpfarekdwdftfalqdvlcappaeagdlalifkllpllereqagsamallqslntprmavsfptrs lggrgkgmeanyaawfegglpaefeiedkktigteliylikkng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.2824
    Matthews' coefficent 2.30 Rfactor 0.2265
    Waters 40 Solvent Content 46.61

    Ligand Information
    Ligands 5GP (GUANOSINE-5'-MONOPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3b89
    1. Structural bases for 16 S rRNA methylation catalyzed by ArmA and RmtB methyltransferases
    E Schmitt, M Galimand, M Panvert, P Courvalin - Journal of molecular , 2009 - Elsevier
     
    2. Structural basis for the methylation of G1405 in 16S rRNA by aminoglycoside resistance methyltransferase Sgm from an antibiotic producer: a diversity of active sites
    N Husain, KL Tkaczuk, SR Tulsidas - Nucleic acids , 2010 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch