.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bcv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative glycosyltransferase from Bacteroides fragilis. To be Published
    Site NYSGXRC
    PDB Id 3bcv Target Id NYSGXRC-12059a
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS7767,PF00535, YP_212416.1 Molecular Weight 39374.78 Da.
    Residues 342 Isoelectric Point 8.74
    Sequence mipkvsvivpiynvekyldqcvqallaqtlsdieiiliddespdncpkicddyaaqypnikvihkknag lgmacnsgldvatgeyvafcdsddyvdsdmymtmynvaqkytcdavftglkritmagiptgtvthqkef klyknkneihtllkdliasdpyareeraiqvsakvvlyrrnliekkhlrfvserilpsedlifnvdvla nsnivcvlpqtfynyrtnpisishtikkdkfslfkqlyieitdrchrlgvednvqlriqrmflgytrny icnilnssitniekkqitssickdgiwkpiwktyplsvmplphriftfamrhnfyslllvlakikk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.257
    Matthews' coefficent 2.70 Rfactor 0.23
    Waters 104 Solvent Content 54.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bcv
    1. Glycosyltransferases, glycoside hydrolases: surprise, surprise!
    B Henrissat, G Sulzenbacher, Y Bourne - Current opinion in structural , 2008 - Elsevier
     
    2. Update on Mechanisms of Plant Cell Wall Biosynthesis: How plants make cellulose and other (1_ 4)-_-D-glycans
    NC Carpita - Plant physiology, 2011 - Am Soc Plant Biol
     
    3. Mycobacterium tuberculosis glucosyl-3-phosphoglycerate synthase: structure of a key enzyme in methylglucose lipopolysaccharide biosynthesis
    PJB Pereira, N Empadinhas, L Albuquerque - PloS one, 2008 - dx.plos.org
     
    4. Biosynthesis of the Pseudomonas aeruginosa extracellular polysaccharides, alginate, Pel, and Psl
    MJ Franklin, DE Nivens, JT Weadge - Frontiers in , 2011 - ncbi.nlm.nih.gov
     
    5. Functional states of homooligomers: insights from the evolution of glycosyltransferases
    K Hashimoto, T Madej, SH Bryant - Journal of molecular , 2010 - Elsevier
     
    6. Biosynthesis of plant cell wall and related polysaccharides by enzymes of the GT2 and GT48 families
    BA Stone, AK Jacobs, M Hrmova, RA Burton - 2010 - books.google.com
     
    7. The molecular and cellular characterisation of the first glycocin, plantaricin KW30: a thesis presented in partial fulfillment of the requirements for the degree of Doctor of
    J Stepper - 2010 - mro.massey.ac.nz
     
    8. Bioinformatick studium glykosyltransferas z patogenu Mycobacterium tuberculosis
    L _tver_kov - 2010 - is.muni.cz
     
    9. High-yield production, refolding and a molecular modelling of the catalytic module of (1, 3)-_-d-glucan (curdlan) synthase from Agrobacterium sp.
    M Hrmova, BA Stone, GB Fincher - Glycoconjugate journal, 2010 - Springer
     
    10. Oligomerization of the reversibly glycosylated polypeptide: its role during rice plant development and in the regulation of self-glycosylation
    V De Pino, C Marino Busjle, S Moreno - Protoplasma, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch