.
The Open Protein Structure Annotation Network
PDB Keyword
.

3be7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional identification of incorrectly annotated prolidases from the amidohydrolase superfamily of enzymes. Biochemistry 48 3730-3742 2009
    Site NYSGXRC
    PDB Id 3be7 Target Id NYSGXRC-9359b
    Related PDB Ids 3dug 
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7826,PF01979 Molecular Weight 43171.01 Da.
    Residues 398 Isoelectric Point 5.60
    Sequence mtsedflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipglmdshvhivgnd skgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvrdaiergvingptmlvsgpalgi tgghcdhnllppefnyssegvvdspwearkmvrknrkygadlikfcatggvmsrntdvnakqftleemk aivdeahnhgmkvaahahgligikaaikagvdsvehasfiddetidmaiknntvlsmdifvsdyilgeg akagireeslnkerlvgkkqrenfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqas tiktatlfgienigqikegfdadivgvienplanirtleevafvmkegkvykr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.30 Rfree 0.27981
    Matthews' coefficent 2.98 Rfactor 0.22602
    Waters 572 Solvent Content 58.73

    Ligand Information
    Ligands ARG (GLYCEROL) x 8;GOL x 16
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3be7
    1. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    2. N-Acetyl-D-glucosamine-6-phosphate deacetylase: substrate activation via a single divalent metal ion
    S Richard, DF Xiang, C Xu, FM Raushel - Biochemistry, 2007 - ACS Publications
     
    3. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    4. Functional Identification of Incorrectly Annotated Prolidases from the Amidohydrolase Superfamily of Enzymes
    DF Xiang, Y Patskovsky, C Xu, AJ Meyer - Biochemistry, 2009 - ACS Publications
     
    5. Functional identification and structure determination of two novel prolidases from cog1228 in the amidohydrolase superfamily
    DF Xiang, Y Patskovsky, C Xu, AA Fedorov - Biochemistry, 2010 - ACS Publications
     
    6. Gulosibacter molinativorax ON4T Molinate Hydrolase, a Novel Cobalt-Dependent Amidohydrolase
    M Duarte, F Ferreira-da-Silva, H Lnsdorf - Journal of , 2011 - Am Soc Microbiol
     
    7. Combining molecular simulation techniques to predict the binding modes of oseltamivir, zanamivir and natural herb products with the neuramindase of the H1N1
    YT Wang, C Chan - Bioinformatics and Biomedical Technology , 2010 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch