.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bga

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482. To be Published
    Site NYSGXRC
    PDB Id 3bga Target Id NYSGXRC-12014c
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS7765,PF02836, NP_810539.1 Molecular Weight 116251.63 Da.
    Residues 1022 Isoelectric Point 6.73
    Sequence mklkkrtflilmaaltatfasaqkqplpewqsqyavglnklaphtyvwpyadasdigkpggyeqspyym slngkwkfnwvknpdnrpkdfyqpsyytggwadinvpgnwerqgygtaiyvnetyefddkmfnfkknpp lvpfaenevgsyrrtfkvpadwkgrrvvlccegvisfyyvwvngkllgynqgsktaaewditdvlsege nvvalevyrwssgaylecqdmwrlsgierdvylystpkqyiadykvsasldkekykegifnlevtvegp satassiaytlkdasgkavlqdainiksrglsnfiafdekkiaevkawnaehpnlytlvlelkdaqgkv teltgcevgfrtseikdgrfcingvpvlvkgtnrhehsqlgrtvskelmeqdirlmkqhninmvrnshy pthpywyqlcdryglymideanieshgmgygpaslakdstwltahmdrthrmyersknhpaiviwsqgn eagnginfertydwlksvekgrpvqyeraelnyntdiycrmyrsvdeikayvgkkdiyrpfilceylha mgnscggmkeywevfenepmaqggciwdwvdqnfreidkdgkwywtyggdygpegipsfgnfcgnglvn avrephphllevkkiyqnikatlsdrknlkvciknwydfsnlneyilrwnvkgedgtvlaegtkevdce phatvdvtlgavklpntvreaylnlswsrkeatplvdtdwevaydqfvlagnknttayrpqkagetafv vdkntgalssltldgkellaapitlslfrpatdndnrdrngarlwrkaglnnltqkvvslkeektsatv raeilngkgqkvgmadfvyaldkngalkvrttfqpdtaivksmarlgltfrmadaynqvsylgrgdhet yidrnqsgriglydttvermfhyyatpqstanrtdvrwakltdqagegvfmesnrpfqfsiipfsdvll ekahhinelerdgmitihldaeqagvgtatcgpgvlpqylvpvkkqsfeftlypvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.234
    Matthews' coefficent 2.55 Rfactor 0.200
    Waters 1137 Solvent Content 51.85

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2;MG (MAGNESIUM) x 2;NA (SODIUM) x 4

    Jmol

     
    Google Scholar output for 3bga
    1. Crystal structures of Trichoderma reesei _-galactosidase reveal conformational changes in the active site
    M Maksimainen, N Hakulinen, JM Kallio - Journal of Structural , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch