.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bge

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C-terminal fragment of AAA+ATPase from Haemophilus influenzae. To be Published
    Site NYSGXRC
    PDB Id 3bge Target Id NYSGXRC-10353u
    Molecular Characteristics
    Source Haemophilus influenzae
    Alias Ids TPS8020,Q4QL22_HAEI8, BIG_278 Molecular Weight 50275.42 Da.
    Residues 446 Isoelectric Point 6.01
    Sequence msnlnfdfaendfrplaakmrptnleqyfgqshligegkplrkaiqaghihsmilwgppgtgkttlaei iaqrinaeverisavtsgikeireaidrakqnrladrktilfvdevhrfnksqqdaflphiedgtvifi gattenpsfelnnallsrarvyvlkslttaeieqvlqqavedperglgkerlileenllqvlaeyvngd arlalnclelmvdmademengkkidrtllkevlgerqarfdkqgdrfydlisalhksvrgsapdaalyw yariltaggdplyvarrllaiasedvgnadpramqvalaawdcftrvgayegeraiaqaiiylavapks navytafntakqqakdlpdydvpphlrnaptnlmkelgygaeyryahdepnayaagenyfppelkdtqy yfptnrgmeiqikeklerlreqdkstvkkryk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.240
    Matthews' coefficent 1.99 Rfactor 0.187
    Waters 220 Solvent Content 38.26

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 3bge
    1. Structure and biochemical activities of Escherichia coli MgsA
    AN Page, NP George, AH Marceau, MM Cox - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch