.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bhw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Magnetospirillum magneticum. To be Published
    Site NYSGXRC
    PDB Id 3bhw Target Id NYSGXRC-10437d
    Molecular Characteristics
    Source Magnetospirillum magneticum
    Alias Ids TPS8048,Q2W5N3_MAGMM, BIG_41 Molecular Weight 22962.29 Da.
    Residues 199 Isoelectric Point 8.79
    Sequence maeprykadigggslklpesriiaglllegvtedqwrhaievenvlqrrspgtakrqsslmrnrletmg pelwqmvrdgstqvaiqavfaaaikhstllgdfldlvvrdqfrmfrpdlprkmwdqyleqcrnrdplmp vwqdstankladcvyrilvevgyitdsktyrlksvrisgevmsylrenneqyvirciqvsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.281
    Matthews' coefficent 1.83 Rfactor 0.239
    Waters 295 Solvent Content 32.75

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch