The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a probable LacI family transcriptional regulator from Corynebacterium glutamicum. To be Published
    Site NYSGXRC
    PDB Id 3bil Target Id NYSGXRC-11020c
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS7886,, PF00532, Q8NQQ9_CORGL Molecular Weight 36566.48 Da.
    Residues 346 Isoelectric Point 5.45
    Sequence matekfrptlkdvarqagvsiatasraladnpavaastreriqqlasdlgyranaqaralrssrsntig vivpslinhyfaamvteiqstaskaglatiitnsnedattmsgslefltshgvdgiicvpneecanqle dlqkqgmpvvlvdrelpgdstiptatsnpqpgiaaavellahnnalpigylsgpmdtstgrerledfka acanskigeqlvflggyeqsvgfegatklldqgaktlfagdsmmtigvieachkaglvigkdvsvigfd thplfalqphpltvidqnveqlaqravsilteliagtvpsvtkttiptalihresiinstlrkkdglpne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.278
    Matthews' coefficent 2.17 Rfactor 0.218
    Waters 20 Solvent Content 43.22

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch