.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bjs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Member of Enolase Superfamily from Polaromonas sp. JS666. To be Published
    Site NYSGXRC
    PDB Id 3bjs Target Id NYSGXRC-9356a
    Molecular Characteristics
    Source Polaromonas sp. js666
    Alias Ids TPS7825,PF02746 Molecular Weight 45445.58 Da.
    Residues 418 Isoelectric Point 6.80
    Sequence mqwecwpslpcwrcfaasgritlsikrftqnsrrhdmkitkinaiplsyrlpegktvtmgvgstikrda iiirvetsegitgygeahpgrspgaitslihntiapmligmkatdcvgawqrvhrmqlsshglgagaal aisgidmalwdirgkaanmplyellggskrripayaggialgyqpkeslaeeaqeyiargykalklrig daarvdiervrhvrkvlgdevdiltdantaytmadarrvlpvlaeiqagwleepfacndfasyrevaki tplvpiaagenhytrfefgqmldagavqvwqpdlskcggitegiriaamasayripinahssatglnha atihflaatenagyfeacvskfnpfrdmfgtsfeigadgcveppdapglgievdesifekypavdgpgyvvkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.26337
    Matthews' coefficent 2.31 Rfactor 0.20519
    Waters 27 Solvent Content 46.74

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3bjs
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch