.
The Open Protein Structure Annotation Network
PDB Keyword
.

3box

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Evolution of enzymatic activities in the enolase superfamily: L-rhamnonate dehydratase. Biochemistry 47 9944-9954 2008
    Site NYSGXRC
    PDB Id 3box Target Id NYSGXRC-9265a
    Related PDB Ids 3d46 2gsh 2p3z 3d47 
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS7795,16765618, PF01188 Molecular Weight 44703.86 Da.
    Residues 405 Isoelectric Point 5.92
    Sequence menimtlpkikhvrawfiggataekgagggdyhdqggnhwiddhiatpmskyrdyeqsrqsfginvlgt liveveaenrqtgfavstagemgcfivekhlnrfiegkcvsdiklihdqmlgatmyysgsgglvmntis cvdlalwdlfgkvvglpvykllggavrdeiqfyatgarpdlakemgfiggkmpthwgphdgdagirkda amvadmrekcgpdfwlmldcwmsqdvnyatklahacapfnlkwieeclppqqyegyrelkrnapagmmv tsgehhgtlqsfrtlaetgidimqpdvgwcgglttlveiaalaksrgqlvvphgssvyshhavitftnt pfseflmtspdcstlrpqfdpilldepvpvngrihksvldkpgfgvelnrdchlkrpysh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.224
    Matthews' coefficent 2.28 Rfactor 0.201
    Waters 459 Solvent Content 46.02

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3box
    1. Evolution of Enzymatic Activities in the Enolase Superfamily: l-Rhamnonate Dehydratase
    JF Rakus, AA Fedorov, EV Fedorov, ME Glasner - Biochemistry, 2008 - ACS Publications
     
    2. Evolution of Enzymatic Activities in the Enolase Superfamily: d-Mannonate Dehydratase from Novosphingobium aromaticivoran s
    JF Rakus, AA Fedorov, EV Fedorov, ME Glasner - Biochemistry, 2007 - ACS Publications
     
    3. Crystal Structure and Functional Assignment of YfaU, a Metal Ion Dependent Class II Aldolase from Escherichia coli K12
    D Rea, R Hovington, JF Rakus, JA Gerlt, V Fu_lo_p - Biochemistry, 2008 - ACS Publications
     
    4. Adaptor Protein Self-Assembly Drives the Control of a Cullin-RING Ubiquitin Ligase
    WJ Errington, MQ Khan, SA Bueler, JL Rubinstein - Structure, 2012 - Elsevier
     
    5. Insights into BTB-Cul3 Ubiquitin Ligases from the Structures of SPOP-Substrate Complexes
    M Zhuang - 2009 - etd.uthsc.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch