.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bpd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein (O28723_ARCFU) from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 3bpd Target Id NYSGXRC-10197b
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7996,O28723, PF02680 Molecular Weight 10466.50 Da.
    Residues 95 Isoelectric Point 4.84
    Sequence vkglrrlvldvlkphepktivfalklselenvdgvnihlseidqatenikitilgnnldyeqikgvied lggvihsvdevvagkiivesvkteqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 14
    Resolution (Å) 2.80 Rfree 0.305
    Matthews' coefficent 2.45 Rfactor 0.242
    Waters 91 Solvent Content 49.82

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 27

    Jmol

     
    Google Scholar output for 3bpd
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch