.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bqs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Listeria monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3bqs Target Id NYSGXRC-10114f
    Related PDB Ids 3bqt 
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS7970,Q71W18, PF04994 Molecular Weight 9248.17 Da.
    Residues 83 Isoelectric Point 5.63
    Sequence manlselpnigkvleqdlikagiktpgelkdvgskeaflriwendssvclselyalegavqgirwhgld eakkielkkfhqsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.42 Rfree 0.272
    Matthews' coefficent 1.81 Rfactor 0.238
    Waters 123 Solvent Content 32.16

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bqs
    1. To automate or not to automate: this is the question
    M Cymborowski, M Klimecka, M Chruszcz - Journal of structural and , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch