.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bqt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein of unknown function from Listeria monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 3bqt Target Id NYSGXRC-10114f
    Related PDB Ids 3bqs 
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS7969,Q71W18, PF04994 Molecular Weight 9248.17 Da.
    Residues 83 Isoelectric Point 5.63
    Sequence manlselpnigkvleqdlikagiktpgelkdvgskeaflriwendssvclselyalegavqgirwhgld eakkielkkfhqsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.299
    Matthews' coefficent 2.54 Rfactor 0.269
    Waters 46 Solvent Content 51.67

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch