The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High resolution crystal structure of a glyoxalase-related enzyme from Fulvimarina pelagi. To be Published
    Site NYSGXRC
    PDB Id 3bqx Target Id NYSGXRC-11003j
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS7858,Q0G7J9_9RHIZ, PF00903, Molecular Weight 15015.34 Da.
    Residues 140 Isoelectric Point 4.84
    Sequence mqqvavitlgigdleasarfygegfgwapvfrnpeiifyqmngfvlatwlvqnlqedvgvavtsrpgsm alahnvraetevaplmerlvaaggqllrpadapphgglrgyvadpdghiweiafnpvwpigadgsvtfa ak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.248
    Matthews' coefficent 2.38 Rfactor 0.238
    Waters 158 Solvent Content 48.26

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch