.
The Open Protein Structure Annotation Network
PDB Keyword
.

3brs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sugar transporter from Clostridium phytofermentans. To be Published
    Site NYSGXRC
    PDB Id 3brs Target Id NYSGXRC-11009m
    Molecular Characteristics
    Source Clostridium phytofermentans
    Alias Ids TPS7869,3.40.50.2300, PF00532, Q1FMG2_9CLOT Molecular Weight 36504.56 Da.
    Residues 325 Isoelectric Point 5.25
    Sequence vkhkkiflisasmlltlslaffiyirtlekpkqyymicipkvlddssdfwsvlvegaqmaakeyeikle fmapekeedylvqnelieeaikrkpdvillaaadyektydaakeikdagiklividsgmkqdiaditva tdniqagirigavtknlvrksgkigvisfvknsktamdreeglkiglsddsnkieaiyycdsnydkayd gtvelltkypdisvmvglnqysatgaaraikdmsleakvklvcidssmeqiqyleegifeamvvqkpfn igylgvekalkllkkeyvpkqldsgcalitkdnmfigmnqklifpfkee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.28284
    Matthews' coefficent 2.43 Rfactor 0.20339
    Waters 265 Solvent Content 49.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3brs
    1. Allosteric regulation of Argonaute proteins by miRNAs
    S Djuranovic, MK Zinchenko, JK Hur, A Nahvi - Nature structural & , 2010 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch