.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bsm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens. To be Published
    Site NYSGXRC
    PDB Id 3bsm Target Id NYSGXRC-9262h
    Molecular Characteristics
    Source Chromohalobacter salexigens
    Alias Ids TPS7790,PF02746 Molecular Weight 45204.77 Da.
    Residues 403 Isoelectric Point 5.71
    Sequence mkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdagriedtwqy lyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmtyahctgqtiedclgevarh velgyravrvqsgvpgiettygvaktpgeryepadsslpaehvwstekylnhapklfaavrerfgddlh vlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttplaigevfnsihdcreliq nqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmpht detdavfphdyrfedghflagespghgvdideelaakypyeraslpvnrledgtlwhw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.268
    Matthews' coefficent 2.04 Rfactor 0.243
    Waters 212 Solvent Content 39.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bsm
    1. Target selection and annotation for the structural genomics of the amidohydrolase and enolase superfamilies
    U Pieper, R Chiang, JJ Seffernick, SD Brown - Journal of structural and , 2009 - Springer
     
    2. Crystal structures of Streptococcus suis mannonate dehydratase (ManD) and its complex with substrate: genetic and biochemical evidence for a catalytic mechanism
    Q Zhang, F Gao, H Peng, H Cheng, Y Liu - Journal of , 2009 - Am Soc Microbiol
     
    3. Structural adaptation of extreme halophilic proteins through decrease of conserved hydrophobic contact surface
    A Siglioccolo, A Paiardini, M Piscitelli - BMC Structural , 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch