The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a glyoxalase-related enzyme from Clostridium phytofermentans. To be Published
    Site NYSGXRC
    PDB Id 3bt3 Target Id NYSGXRC-11003f
    Molecular Characteristics
    Source Clostridium phytofermentans
    Alias Ids TPS7857,PF00903,, Q1FJ26_9CLOT Molecular Weight 30390.99 Da.
    Residues 265 Isoelectric Point 5.70
    Sequence mdwqkgmnsaidyieknltgnvnvrtaagfvgcstwefqrifsflthiplseyirqrkltlaaqeikdn dvkiidialkygyespaafsrafnklfgiapssvrntennlktypritfekienerlikmsrfsergyv vrengpvyftkdmdktvkwfeeilgwsgdivarddegfgdygcvfdypsevavahltpfrgfhlfkgep ikgvagfmmiegidalhkyvkengwdqisdiytqpwgarecsitttdgcilrffesiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.27
    Matthews' coefficent 2.81 Rfactor 0.222
    Waters 91 Solvent Content 56.27

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch