.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bt5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DUF305 fragment from Deinococcus radiodurans. To be Published
    Site NYSGXRC
    PDB Id 3bt5 Target Id NYSGXRC-10080d
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS7955,Q9RVD0, PF03713 Molecular Weight 21951.56 Da.
    Residues 197 Isoelectric Point 7.16
    Sequence mrrgwlwgallvllgvlaalllrpplppatpqevqfvqhmlqhhaqaldlaapmlersqqrtvrslald iqlsqreqmrqmeamlgrwgqppgepispeharmmgmaseaevaglstlpveqaerqflrlmirhhqga vamtlpmldaaarpeverlarqivvtqrgeirtmegvlgrldgevpaapmrpvehghgh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.188
    Matthews' coefficent 2.22 Rfactor 0.154
    Waters 126 Solvent Content 44.68

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch