.
The Open Protein Structure Annotation Network
PDB Keyword
.

3but

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein Af_0446 from Archaeoglobus fulgidus. To be Published
    Site NYSGXRC
    PDB Id 3but Target Id NYSGXRC-10193b
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS7993,PF07427, O29803 Molecular Weight 14118.61 Da.
    Residues 126 Isoelectric Point 8.90
    Sequence vesvkamwgvvtdsqteivalakvrnedvvpivvsgyhytiemngvkvadgyenspvtvkpkskttlkf slrlnnsfirewwvthiangektkirvaikptievggrdvevpvflresefttklls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.91 Rfree 0.29963
    Matthews' coefficent 1.82 Rfactor 0.22606
    Waters 50 Solvent Content 32.10

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch