.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bvc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein Ism_01780 from Roseovarius nubinhibens. To be Published
    Site NYSGXRC
    PDB Id 3bvc Target Id NYSGXRC-10416j
    Molecular Characteristics
    Source Roseovarius nubinhibens
    Alias Ids TPS8038,BIG_189, ZP_00958517 Molecular Weight 23073.54 Da.
    Residues 206 Isoelectric Point 4.62
    Sequence maqisslfvtrlyhaplsdhgpaidaeemesscyaiaeddeagqgwceengypgytsyasltdlpwrfp ifadlvksldahvaafaedlefdldgraleledlwinilpeggshashihphsvisgttyvsmpggtsa lkledprhammmaaparrktardelrqfiyvtpavgdvllweswlrhevpmnmseddrisvsfnyrwa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.75 Rfree 0.29796
    Matthews' coefficent 3.93 Rfactor 0.25541
    Waters 4 Solvent Content 68.71

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 4;NI (NICKEL) x 2

    Jmol

     
    Google Scholar output for 3bvc
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. BetaSearch: a new method for querying beta-residue motifs
    HK Ho, G Gange, MJ Kuiper - BMC Research , 2012 - biomedcentral.com
     
    3. The human collagen beta (1-O) galactosyltransferase, GLT25D1, is a soluble endoplasmic reticulum-localised protein
    S Punt, WJM Spaan - Hepatitis C virus , 2010 - openaccess.leidenuniv.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch