.
The Open Protein Structure Annotation Network
PDB Keyword
.

3by5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of cobalamin biosynthesis protein from Agrobacterium tumefaciens str. C58. To be Published
    Site NYSGXRC
    PDB Id 3by5 Target Id NYSGXRC-10037i
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS7938,PF01890, Q8UBQ4 Molecular Weight 14466.43 Da.
    Residues 145 Isoelectric Point 4.68
    Sequence melgqamvtvagigcrkgaasdaiiaavraaerafgvtvdylataplkadeaglaeaakglslsleiva qerleavaaetmtfsqasldhsgspsvseaaalaaagagarlvaprlvvgdvtvaiamtsdaphgsrsa ieygeqe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.52 Rfree 0.27187
    Matthews' coefficent 2.22 Rfactor 0.21144
    Waters 13 Solvent Content 44.51

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3by5
    1. Fifteen years of HIV Protease Inhibitors: raising the barrier to resistance
    AMJ Wensing, NM Van Maarseveen, M Nijhuis - Antiviral research, 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch