.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c19

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein MK0293 from Methanopyrus kandleri AV19. To be Published
    Site NYSGXRC
    PDB Id 3c19 Target Id NYSGXRC-10070i
    Molecular Characteristics
    Source Methanopyrus kandleri
    Alias Ids TPS7948,PF01969, Q8TYK3 Molecular Weight 19550.13 Da.
    Residues 176 Isoelectric Point 4.55
    Sequence mgldyepshlmflvtvlddrdgevlgdaiqkliereevlachavpcvtkknrpghvlvvlvdggedpdr vaedvardimvltgstgvdrfdadgvysvpsrfedvrvvygerewrvsvkiaeteegevvtvkaefdec reigeetgipprevkamveaaarvggwvdlkereikvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.26905
    Matthews' coefficent 2.56 Rfactor 0.24868
    Waters 12 Solvent Content 51.89

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c19
    1. Capturing Structure_ Activity Relationships from Chemogenomic Spaces
    B Wendt, U Uhrig, F Bo_s - Journal of chemical information and , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch