.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c3k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an uncharacterized protein from Actinobacillus succinogenes. To be Published
    Site NYSGXRC
    PDB Id 3c3k Target Id NYSGXRC-11007f
    Molecular Characteristics
    Source Actinobacillus succinogenes
    Alias Ids TPS7864,3.40.50.2300, PF00532, Q3EIU5_ACTSC Molecular Weight 35620.13 Da.
    Residues 327 Isoelectric Point 8.27
    Sequence vsiqdlarragvsvatvsrvlnnqpsvkpqnkekvlaaikelnyqpnllarqlrtaktgmllvmvsnia npfcaavvkgiektaekngyrillcntesdlarsrscltllsgkmvdgvitmdalselpelqniigafp wvqcaeydplstvssvsiddvaaseyvvdqlvksgkkrialinhdlayqyaqhresgylnrlkfhgldy srisyaenldymagklatfsllksavkpdaifaisdvlaagaiqaltesglsipqdvavvgfdgvdisq itvpalttvqqpseqigmkavsllleqihsdvlaktvhhllpwkfvrrqss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.99 Rfree 0.231
    Matthews' coefficent 1.94 Rfactor 0.180
    Waters 253 Solvent Content 36.49

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3c3k
    1. The crystal structure of alanine racemase from Streptococcus pneumoniae, a target for structure-based drug design
    H Im, ML Sharpe, U Strych, M Davlieva - BMC , 2011 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch