.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c6f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein Bsu07140 from Bacillus subtilis. To be Published
    Site NYSGXRC
    PDB Id 3c6f Target Id NYSGXRC-10076b
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS7949,O31533, PF04239 Molecular Weight 26308.39 Da.
    Residues 231 Isoelectric Point 6.76
    Sequence mgnylsvavelvcglgilfiilkllgktqfsqitpfdfisalilgelvgnavydheikikeiifasllw gvliyiiefitqkmkssrkflegepnivirkgelqykvmkknkidinqlqsllrqagsfsiqeveyail etngmvsvlpksdfdkptnkdlqipsksvslpitliidgeivrdnlkeagvdeqwlkqelkkknidkte dvlfaewhknkplytvtyeqsrst
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.28763
    Matthews' coefficent 2.23 Rfactor 0.23289
    Waters 65 Solvent Content 44.93

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch